Lineage for d1vgxb_ (1vgx B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237726Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2237727Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2237971Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
    automatically mapped to Pfam PF02664
  6. 2237972Protein Autoinducer-2 production protein LuxS [64295] (5 species)
    S-ribosylhomocysteinase
  7. 2237981Species Deinococcus radiodurans [TaxId:1299] [64297] (5 PDB entries)
  8. 2237985Domain d1vgxb_: 1vgx B: [100619]
    structural genomics
    complexed with zn

Details for d1vgxb_

PDB Entry: 1vgx (more details), 1.9 Å

PDB Description: crystal structure of a autoinducer-2 synthesis protein
PDB Compounds: (B:) S-ribosylhomocysteinase

SCOPe Domain Sequences for d1vgxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgxb_ d.185.1.2 (B:) Autoinducer-2 production protein LuxS {Deinococcus radiodurans [TaxId: 1299]}
nvesfdldhtkvkapyvrlagvkttpkgdqiskydlrflqpnqgaidpaaihtlehllag
ymrdhlegvvdvspmgcrtgmymavigepdeqgvmkafeaalkdtaghdqpipgvselec
gnyrdhdlaaarqhardvldqglkvqetill

SCOPe Domain Coordinates for d1vgxb_:

Click to download the PDB-style file with coordinates for d1vgxb_.
(The format of our PDB-style files is described here.)

Timeline for d1vgxb_: