Lineage for d1vgwc_ (1vgw C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133681Family c.68.1.13: Cytidylytransferase [68901] (7 protein domains)
  6. 2133682Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 2133693Species Neisseria gonorrhoeae [TaxId:485] [102605] (2 PDB entries)
  8. 2133696Domain d1vgwc_: 1vgw C: [100614]
    structural genomics

Details for d1vgwc_

PDB Entry: 1vgw (more details), 2.35 Å

PDB Description: crystal structure of 4-diphosphocytidyl-2c-methyl-d-erythritol synthase
PDB Compounds: (C:) 4-diphosphocytidyl-2C-methyl-D-erythritol synthase

SCOPe Domain Sequences for d1vgwc_:

Sequence, based on SEQRES records: (download)

>d1vgwc_ c.68.1.13 (C:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]}
slkrknialipaagigvrfgadkpkqyveigsktvlehvlgiferheavdltvvvvsped
tfadkvqtafpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsea
larlieqagnaaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhral
aaenlggitdeasaveklgvrplliqgdarnlkltqpqdayivrllld

Sequence, based on observed residues (ATOM records): (download)

>d1vgwc_ c.68.1.13 (C:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]}
slkrknialipaagpkqyveigsktvlehvlgiferheavdltvvvvspedtfadkvqta
fpqvrvwknggqtraetvrngvaklletglaaetdnilvhdaarcclpsealarlieqag
naaeggilavpvadtlkraesgqisatvdrsglwqaqtpqlfqagllhralaaitdeasa
veklgvrplliqgdarnlkltqpqdayivrllld

SCOPe Domain Coordinates for d1vgwc_:

Click to download the PDB-style file with coordinates for d1vgwc_.
(The format of our PDB-style files is described here.)

Timeline for d1vgwc_: