Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) |
Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 proteins) automatically mapped to Pfam PF02350 |
Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species) |
Species Escherichia coli [TaxId:562] [53765] (2 PDB entries) |
Domain d1vgvd1: 1vgv D:2-374 [100611] Other proteins in same PDB: d1vgva2, d1vgvb2, d1vgvc2, d1vgvd2 structural genomics complexed with ud1 |
PDB Entry: 1vgv (more details), 2.31 Å
SCOPe Domain Sequences for d1vgvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vgvd1 c.87.1.3 (D:2-374) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} kvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlnim qpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveaglr tgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwvr dqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiqi vypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapslg kpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgqa csrilealknnri
Timeline for d1vgvd1: