Lineage for d1vgvc_ (1vgv C:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 402819Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 402820Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (7 families) (S)
  5. 402851Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (1 protein)
  6. 402852Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species)
  7. 402856Species Escherichia coli [TaxId:562] [53765] (2 PDB entries)
  8. 402863Domain d1vgvc_: 1vgv C: [100610]

Details for d1vgvc_

PDB Entry: 1vgv (more details), 2.31 Å

PDB Description: crystal structure of udp-n-acetylglucosamine_2 epimerase

SCOP Domain Sequences for d1vgvc_:

Sequence, based on SEQRES records: (download)

>d1vgvc_ c.87.1.3 (C:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli}
mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
mqpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveagl
rtgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwv
rdqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiq
ivypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapsl
gkpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgq
acsrilealknnr

Sequence, based on observed residues (ATOM records): (download)

>d1vgvc_ c.87.1.3 (C:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli}
mkvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlni
gqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveaglrtg
dlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwvrdq
vmssdklrselaanypfidpdkkmilvtghrfgrgfeeichaladiatthqdiqivypvh
lnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapslgkpvlv
mrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgqacsril
ealknnr

SCOP Domain Coordinates for d1vgvc_:

Click to download the PDB-style file with coordinates for d1vgvc_.
(The format of our PDB-style files is described here.)

Timeline for d1vgvc_: