Lineage for d1vgvc1 (1vgv C:2-373)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142080Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 protein domains)
    automatically mapped to Pfam PF02350
  6. 2142081Protein UDP-N-acetylglucosamine 2-epimerase [53764] (3 species)
  7. 2142085Species Escherichia coli [TaxId:562] [53765] (2 PDB entries)
  8. 2142092Domain d1vgvc1: 1vgv C:2-373 [100610]
    Other proteins in same PDB: d1vgva2, d1vgvb2, d1vgvc2, d1vgvd2
    structural genomics
    complexed with ud1

Details for d1vgvc1

PDB Entry: 1vgv (more details), 2.31 Å

PDB Description: crystal structure of udp-n-acetylglucosamine_2 epimerase
PDB Compounds: (C:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d1vgvc1:

Sequence, based on SEQRES records: (download)

>d1vgvc1 c.87.1.3 (C:2-373) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]}
kvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlnim
qpgqglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveaglr
tgdlyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwvr
dqvmssdklrselaanypfidpdkkmilvtghrresfgrgfeeichaladiatthqdiqi
vypvhlnpnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapslg
kpvlvmrdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgqa
csrilealknnr

Sequence, based on observed residues (ATOM records): (download)

>d1vgvc1 c.87.1.3 (C:2-373) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]}
kvltvfgtrpeaikmaplvhalakdpffeakvcvtaqhremldqvlklfsivpdydlnig
qglteitcrileglkpilaefkpdvvlvhgdttttlatslaafyqripvghveaglrtgd
lyspwpeeanrtltghlamyhfsptetsrqnllrenvadsrifitgntvidallwvrdqv
mssdklrselaanypfidpdkkmilvtghrfgrgfeeichaladiatthqdiqivypvhl
npnvrepvnrilghvknvilidpqeylpfvwlmnhawliltdsggiqeeapslgkpvlvm
rdtterpeavtagtvrlvgtdkqriveevtrllkdeneyqamsrahnpygdgqacsrile
alknnr

SCOPe Domain Coordinates for d1vgvc1:

Click to download the PDB-style file with coordinates for d1vgvc1.
(The format of our PDB-style files is described here.)

Timeline for d1vgvc1: