![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) ![]() |
![]() | Family c.68.1.13: Cytidylytransferase [68901] (4 proteins) |
![]() | Protein 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) [64140] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [64141] (6 PDB entries) |
![]() | Domain d1vgtb_: 1vgt B: [100605] structural genomics |
PDB Entry: 1vgt (more details), 1.8 Å
SCOP Domain Sequences for d1vgtb_:
Sequence, based on SEQRES records: (download)
>d1vgtb_ c.68.1.13 (B:) 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) {Escherichia coli} ldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsrf aqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllalse tsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralneg atitdeasaleycgfhpqlvegradnikvtrpedlalaefyltr
>d1vgtb_ c.68.1.13 (B:) 4-diphosphocytidyl-2-c-methylerythritol (CDP-me) synthase (YgbP) {Escherichia coli} ldvcavvpaagfgpkqylsignqtilehsvhallahprvkrvviaispgdsrfaqlplan hpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllalsetsrtggi laapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralnegatitdea saleycgfhpqlvegradnikvtrpedlalaefyltr
Timeline for d1vgtb_: