Lineage for d1vgta_ (1vgt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133681Family c.68.1.13: Cytidylytransferase [68901] (7 protein domains)
  6. 2133682Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 2133683Species Escherichia coli [TaxId:562] [64141] (6 PDB entries)
  8. 2133686Domain d1vgta_: 1vgt A: [100604]
    structural genomics

Details for d1vgta_

PDB Entry: 1vgt (more details), 1.8 Å

PDB Description: crystal structure of 4-diphosphocytidyl-2c-methyl-d-erythritol synthase
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d1vgta_:

Sequence, based on SEQRES records: (download)

>d1vgta_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]}
ldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsrf
aqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllalse
tsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralneg
atitdeasaleycgfhpqlvegradnikvtrpedlalaefyl

Sequence, based on observed residues (ATOM records): (download)

>d1vgta_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]}
ldvcavvpaapkqylsignqtilehsvhallahprvkrvviaissrfaqlplanhpqitv
vdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllalsetsrtggilaapvr
dtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralnegatitdeasaleyc
gfhpqlvegradnikvtedlalaefyl

SCOPe Domain Coordinates for d1vgta_:

Click to download the PDB-style file with coordinates for d1vgta_.
(The format of our PDB-style files is described here.)

Timeline for d1vgta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vgtb_