Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) |
Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (1 protein) |
Protein PetM subunit of the cytochrome b6f complex [103443] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103444] (6 PDB entries) |
Domain d1vf5s_: 1vf5 S: [100597] Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5t_, d1vf5u_ complexed with bcr, cla, fes, hem, opc, pl9, tds |
PDB Entry: 1vf5 (more details), 3 Å
SCOPe Domain Sequences for d1vf5s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf5s_ f.23.25.1 (S:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} mteemlyaallsfglifvgwglgvlllkiqgaeke
Timeline for d1vf5s_: