Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) |
Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103429] (1 PDB entry) |
Domain d1vf5q2: 1vf5 Q:12-45 [100595] Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_ |
PDB Entry: 1vf5 (more details), 3 Å
SCOP Domain Sequences for d1vf5q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf5q2 f.23.12.1 (Q:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus} dmgrrqfmnllafgtvtgvalgalyplvkyfipp
Timeline for d1vf5q2: