Lineage for d1vf5o_ (1vf5 O:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426851Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 426852Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 426853Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 426876Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
  7. 426879Species Mastigocladus laminosus [TaxId:83541] [103496] (1 PDB entry)
  8. 426881Domain d1vf5o_: 1vf5 O: [100590]
    Other proteins in same PDB: d1vf5a_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5o_

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

SCOP Domain Sequences for d1vf5o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5o_ f.32.1.1 (O:) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus}
lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp
ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt
lvtiwlgigaalpldktl

SCOP Domain Coordinates for d1vf5o_:

Click to download the PDB-style file with coordinates for d1vf5o_.
(The format of our PDB-style files is described here.)

Timeline for d1vf5o_: