Lineage for d1vf5f_ (1vf5 F:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887681Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 887682Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (1 protein)
  6. 887683Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 887686Species Mastigocladus laminosus [TaxId:83541] [103444] (5 PDB entries)
  8. 887688Domain d1vf5f_: 1vf5 F: [100586]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5t_, d1vf5u_

Details for d1vf5f_

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (F:) protein pet m

SCOP Domain Sequences for d1vf5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
mteemlyaallsfglifvgwglgvlllkiqgae

SCOP Domain Coordinates for d1vf5f_:

Click to download the PDB-style file with coordinates for d1vf5f_.
(The format of our PDB-style files is described here.)

Timeline for d1vf5f_: