| Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
| Fold f.23: Single transmembrane helix [81407] (30 superfamilies) not a true fold |
Superfamily f.23.24: PetL subunit of the cytochrome b6f complex [103436] (1 family) ![]() |
| Family f.23.24.1: PetL subunit of the cytochrome b6f complex [103437] (1 protein) |
| Protein PetL subunit of the cytochrome b6f complex [103438] (2 species) |
| Species Mastigocladus laminosus [TaxId:83541] [103439] (1 PDB entry) |
| Domain d1vf5e_: 1vf5 E: [100585] Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5s_, d1vf5t_, d1vf5u_ |
PDB Entry: 1vf5 (more details), 3 Å
SCOP Domain Sequences for d1vf5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf5e_ f.23.24.1 (E:) PetL subunit of the cytochrome b6f complex {Mastigocladus laminosus}
milgavfyivfialffgiavgiifaiksikli
Timeline for d1vf5e_: