Lineage for d1vf5c3 (1vf5 C:250-286)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887660Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family) (S)
  5. 887661Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein)
  6. 887662Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species)
  7. 887665Species Mastigocladus laminosus [TaxId:83541] [103434] (1 PDB entry)
  8. 887666Domain d1vf5c3: 1vf5 C:250-286 [100582]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_

Details for d1vf5c3

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (C:) cytochrome f

SCOP Domain Sequences for d1vf5c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5c3 f.23.23.1 (C:250-286) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
qdpnrvkwmiaficlvmlaqlmlilkkkqvekvqaae

SCOP Domain Coordinates for d1vf5c3:

Click to download the PDB-style file with coordinates for d1vf5c3.
(The format of our PDB-style files is described here.)

Timeline for d1vf5c3: