| Class b: All beta proteins [48724] (149 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) ![]() |
| Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein) |
| Protein Cytochrome f, small domain [51257] (4 species) |
| Species Mastigocladus laminosus [TaxId:83541] [102005] (1 PDB entry) |
| Domain d1vf5c2: 1vf5 C:170-231 [100581] Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_ |
PDB Entry: 1vf5 (more details), 3 Å
SCOP Domain Sequences for d1vf5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf5c2 b.84.2.2 (C:170-231) Cytochrome f, small domain {Mastigocladus laminosus}
nvftasatgtitkiakeedeygnvkyqvsiqtdsgktvvdtipagpelivsegqavkage
al
Timeline for d1vf5c2: