SCOP 1.67: Domain d1vecb_: 1vec B:

Lineage for d1vecb_ (1vec B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (9 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein DEAD box RNA helicase rck/p54 [102387] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102388] (1 PDB entry)

8. Domain d1vecb_: 1vec B: [100576]
   N-terminal domain only
   complexed with tar, zn2

Details for d1vecb_

PDB Entry: 1vec, 2.01 Å

PDB Description: crystal structure of the n-terminal domain of rck/p54, a human dead- box protein

SCOP Domain Sequences for d1vecb_:

Sequence; same for both SEQRES and ATOM records:

>d1vecb_ c.37.1.19 (B:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens)}
kgnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgaylip
llerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimrld
dtvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknrqi
llysatfplsvqkfmnshlekpyein

Timeline for d1vecb_:

• d1vecb_ is new in SCOP 1.67
  
• d1vecb_ appears in SCOP 1.69
  
• d1vecb_ appears in the current release, SCOPe 2.08