![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
![]() | Protein D-aminoacid oxidase [54385] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [54386] (7 PDB entries) |
![]() | Domain d1ve9b2: 1ve9 B:195-287 [100574] Other proteins in same PDB: d1ve9a1, d1ve9b1 complexed with bez, fad |
PDB Entry: 1ve9 (more details), 2.5 Å
SCOPe Domain Sequences for d1ve9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ve9b2 d.16.1.3 (B:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq dhntiwegccrleptlkdakivgeytgfrpvrp
Timeline for d1ve9b2: