Lineage for d1ve9b2 (1ve9 B:195-287)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599429Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 599430Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 599522Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)
  6. 599523Protein D-aminoacid oxidase [54385] (2 species)
  7. 599524Species Pig (Sus scrofa) [TaxId:9823] [54386] (6 PDB entries)
  8. 599526Domain d1ve9b2: 1ve9 B:195-287 [100574]
    Other proteins in same PDB: d1ve9a1, d1ve9b1
    complexed with bez, fad

Details for d1ve9b2

PDB Entry: 1ve9 (more details), 2.5 Å

PDB Description: porcine kidney d-amino acid oxidase

SCOP Domain Sequences for d1ve9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ve9b2 d.16.1.3 (B:195-287) D-aminoacid oxidase {Pig (Sus scrofa)}
lqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlggtfqvgnwneinniq
dhntiwegccrleptlkdakivgeytgfrpvrp

SCOP Domain Coordinates for d1ve9b2:

Click to download the PDB-style file with coordinates for d1ve9b2.
(The format of our PDB-style files is described here.)

Timeline for d1ve9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ve9b1