SCOP 1.67: Domain d1ve9b1: 1ve9 B:1-194,B:288-340

Lineage for d1ve9b1 (1ve9 B:1-194,B:288-340)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
   This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold

6. Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)

8. Domain d1ve9b1: 1ve9 B:1-194,B:288-340 [100573]
   Other proteins in same PDB: d1ve9a2, d1ve9b2
   complexed with bez, fad

Details for d1ve9b1

PDB Entry: 1ve9, 2.5 Å

PDB Description: porcine kidney d-amino acid oxidase

SCOP Domain Sequences for d1ve9b1:

Sequence; same for both SEQRES and ATOM records:

>d1ve9b1 c.4.1.2 (B:1-194,B:288-340) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernll

Timeline for d1ve9b1:

• d1ve9b1 is new in SCOP 1.67
  
• d1ve9b1 appears in SCOP 1.69
  
• d1ve9b1 appears in the current release, SCOPe 2.08