![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
![]() | Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein) This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold |
![]() | Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51981] (7 PDB entries) |
![]() | Domain d1ve9a1: 1ve9 A:1-194,A:288-340 [100571] Other proteins in same PDB: d1ve9a2, d1ve9b2 complexed with bez, fad |
PDB Entry: 1ve9 (more details), 2.5 Å
SCOPe Domain Sequences for d1ve9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ve9a1 c.4.1.2 (A:1-194,A:288-340) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk vleernll
Timeline for d1ve9a1: