Lineage for d1vdua_ (1vdu A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 543270Superfamily a.118.20: Hypothetical protein ST1625 [101424] (1 family) (S)
  5. 543271Family a.118.20.1: Hypothetical protein ST1625 [101425] (1 protein)
  6. 543272Protein Hypothetical protein ST1625 [101426] (1 species)
  7. 543273Species Archaeon Sulfolobus tokodaii [TaxId:111955] [101427] (1 PDB entry)
  8. 543274Domain d1vdua_: 1vdu A: [100568]
    structural genomics
    complexed with zn

Details for d1vdua_

PDB Entry: 1vdu (more details), 2.2 Å

PDB Description: Crystal Structure of hypothetical protein [ST1625] from Hyperthermophilic Archaeon Sulfolobus tokodaii

SCOP Domain Sequences for d1vdua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdua_ a.118.20.1 (A:) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii}
eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki
gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilknnevsa
silvaianalrrvgderdattllieackkgekeacnavntl

SCOP Domain Coordinates for d1vdua_:

Click to download the PDB-style file with coordinates for d1vdua_.
(The format of our PDB-style files is described here.)

Timeline for d1vdua_: