Class a: All alpha proteins [46456] (226 folds) |
Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.20: Hypothetical protein ST1625 [101424] (1 family) |
Family a.118.20.1: Hypothetical protein ST1625 [101425] (1 protein) |
Protein Hypothetical protein ST1625 [101426] (1 species) |
Species Archaeon Sulfolobus tokodaii [TaxId:111955] [101427] (1 PDB entry) |
Domain d1vdua_: 1vdu A: [100568] structural genomics complexed with zn |
PDB Entry: 1vdu (more details), 2.2 Å
SCOP Domain Sequences for d1vdua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vdua_ a.118.20.1 (A:) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii} eiirklmdakkflldgyidegvkivleitksstkseynwficnllesidcrymfqvldki gsyfdldkcqnlksvvecgvinntlnehvnkaldilviqgkrdkleeigreilknnevsa silvaianalrrvgderdattllieackkgekeacnavntl
Timeline for d1vdua_: