Lineage for d1vdkb_ (1vdk B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010329Protein Fumarase [48561] (3 species)
  7. 2010345Species Thermus thermophilus [TaxId:274] [101443] (1 PDB entry)
  8. 2010347Domain d1vdkb_: 1vdk B: [100562]

Details for d1vdkb_

PDB Entry: 1vdk (more details), 1.8 Å

PDB Description: Crystal structure of fumarase from thermus thermophilus HB8
PDB Compounds: (B:) fumarate hydratase class II

SCOPe Domain Sequences for d1vdkb_:

Sequence, based on SEQRES records: (download)

>d1vdkb_ a.127.1.1 (B:) Fumarase {Thermus thermophilus [TaxId: 274]}
rierdtmgevrvpadkywgaqtqrslenfrigtdrfrmpleiiraygmlkkaaaranlel
gelpeeiakaiiqaaeevvqgkwddhfplvvfqtgsgtqtnmnvnevianraseilgkpl
gskyahpndhvnrgqssndtfptamyvavalalhqrlypaveglirtftakaqafdqivk
vgrthlmdavpitlgqeigswaaqlkttlaavkemekglynlaiggtavgtglnahprfg
elvakylaeetglpfrvaenrfaalaahdelvnvmgairtlagalmkigndvrwlasgpy
agigeitipanepgssimpgkvnptqvealtmvvvrvygndhtvafagsqgnfqlnvykp
vmaystlesinlladavasfdahlaqgiepnlerieeylqknpmlatalnkaigydkaae
ivkkalkekktlkqaalelgylteeefdrivvpmrlakph

Sequence, based on observed residues (ATOM records): (download)

>d1vdkb_ a.127.1.1 (B:) Fumarase {Thermus thermophilus [TaxId: 274]}
rierdtmgevrvpadkywgaqtqrslenfrigtdrfrmpleiiraygmlkkaaaranlel
gelpeeiakaiiqaaeevvqgkwddhfplvvfqtgsgtqtnmnvnevianraseilgkpl
gskyahpndhvnrgqssndtfptamyvavalalhqrlypaveglirtftakaqafdqivk
vgrthlmdavpitlgqeigswaaqlkttlaavkemekglynlaiggtavgtglnahprfg
elvakylaeetglpfrvaenrfaalaahdelvnvmgairtlagalmkigndvrwlasgpy
agigeitipanepimpgkvnptqvealtmvvvrvygndhtvafagsqgnfqlnvykpvma
ystlesinlladavasfdahlaqgiepnlerieeylqknpmlatalnkaigydkaaeivk
kalkekktlkqaalelgylteeefdrivvpmrlakph

SCOPe Domain Coordinates for d1vdkb_:

Click to download the PDB-style file with coordinates for d1vdkb_.
(The format of our PDB-style files is described here.)

Timeline for d1vdkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vdka_