Lineage for d1vdka_ (1vdk A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360794Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 360795Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 360796Family a.127.1.1: L-aspartase/fumarase [48558] (5 proteins)
  6. 360843Protein Fumarase [48561] (3 species)
  7. 360859Species Thermus thermophilus [TaxId:274] [101443] (1 PDB entry)
  8. 360860Domain d1vdka_: 1vdk A: [100561]

Details for d1vdka_

PDB Entry: 1vdk (more details), 1.8 Å

PDB Description: Crystal structure of fumarase from thermus thermophilus HB8

SCOP Domain Sequences for d1vdka_:

Sequence, based on SEQRES records: (download)

>d1vdka_ a.127.1.1 (A:) Fumarase {Thermus thermophilus}
rierdtmgevrvpadkywgaqtqrslenfrigtdrfrmpleiiraygmlkkaaaranlel
gelpeeiakaiiqaaeevvqgkwddhfplvvfqtgsgtqtnmnvnevianraseilgkpl
gskyahpndhvnrgqssndtfptamyvavalalhqrlypaveglirtftakaqafdqivk
vgrthlmdavpitlgqeigswaaqlkttlaavkemekglynlaiggtavgtglnahprfg
elvakylaeetglpfrvaenrfaalaahdelvnvmgairtlagalmkigndvrwlasgpy
agigeitipanepgssimpgkvnptqvealtmvvvrvygndhtvafagsqgnfqlnvykp
vmaystlesinlladavasfdahlaqgiepnlerieeylqknpmlatalnkaigydkaae
ivkkalkekktlkqaalelgylteeefdrivvpmrlakph

Sequence, based on observed residues (ATOM records): (download)

>d1vdka_ a.127.1.1 (A:) Fumarase {Thermus thermophilus}
rierdtmgevrvpadkywgaqtqrslenfrigtdrfrmpleiiraygmlkkaaaranlel
gelpeeiakaiiqaaeevvqgkwddhfplvvfqtgsgtqtnmnvnevianraseilgkpl
gskyahpndhvnrgqssndtfptamyvavalalhqrlypaveglirtftakaqafdqivk
vgrthlmdavpitlgqeigswaaqlkttlaavkemekglynlaiggtavgtglnahprfg
elvakylaeetglpfrvaenrfaalaahdelvnvmgairtlagalmkigndvrwlasgpy
agigeitipanepgssimpgkvnptqvealtmvvvrvygndhtvafagsqgnfqlnvykp
vmaystlesinlladavasfdahlaqgiepnlerieeylqknpmlatalnkaigydkaae
ivkkalkktlkqaalelgylteeefdrivvpmrlakph

SCOP Domain Coordinates for d1vdka_:

Click to download the PDB-style file with coordinates for d1vdka_.
(The format of our PDB-style files is described here.)

Timeline for d1vdka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vdkb_