Class i: Low resolution protein structures [58117] (26 folds) |
Fold i.5: Photosystems [58155] (1 superfamily) |
Superfamily i.5.1: Photosystems [58156] (1 family) |
Family i.5.1.1: Photosystems [58157] (5 proteins) not a true family |
Protein Chlorophyll a-b binding protein [103669] (1 species) light-harvesting chlorophyll a/b protein complex with an icosahedral assembly |
Species Garden pea (Pisum sativum) [TaxId:3888] [103670] (1 PDB entry) a higher resolution structure of a homologous protein is also available, PDB entry 1RWT |
Domain d1vcra_: 1vcr A: [100560] |
PDB Entry: 1vcr (more details), 9.5 Å
SCOP Domain Sequences for d1vcra_:
Sequence, based on SEQRES records: (download)
>d1vcra_ i.5.1.1 (A:) Chlorophyll a-b binding protein {Garden pea (Pisum sativum) [TaxId: 3888]} petfsknrelevihsrwamlgalgcvfpellsrngvkfgeavwfkagsqifseggldylg npslvhaqsilaiwatqvilmgavegyriaggplgevvdplypggsfdplgladdpeafa elkvkelkngrlamfsmfgffvqaivtgkgplenladhla
>d1vcra_ i.5.1.1 (A:) Chlorophyll a-b binding protein {Garden pea (Pisum sativum) [TaxId: 3888]} petfsknrelevihsrwamlgalgcvfpellsrngsilaiwatqvilmgavegyripeaf aelkvkelkngrlamfsmfgffvqaivtgkgplenladhla
Timeline for d1vcra_: