Lineage for d1vcra_ (1vcr A:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 527170Fold i.5: Photosystems [58155] (1 superfamily)
  4. 527171Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 527172Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 527173Protein Chlorophyll a-b binding protein [103669] (1 species)
    light-harvesting chlorophyll a/b protein complex with an icosahedral assembly
  7. 527174Species Garden pea (Pisum sativum) [TaxId:3888] [103670] (1 PDB entry)
    a higher resolution structure of a homologous protein is also available, PDB entry 1RWT
  8. 527175Domain d1vcra_: 1vcr A: [100560]

Details for d1vcra_

PDB Entry: 1vcr (more details), 9.5 Å

PDB Description: an icosahedral assembly of light-harvesting chlorophyll a/b protein complex from pea thylakoid membranes

SCOP Domain Sequences for d1vcra_:

Sequence, based on SEQRES records: (download)

>d1vcra_ i.5.1.1 (A:) Chlorophyll a-b binding protein {Garden pea (Pisum sativum)}
petfsknrelevihsrwamlgalgcvfpellsrngvkfgeavwfkagsqifseggldylg
npslvhaqsilaiwatqvilmgavegyriaggplgevvdplypggsfdplgladdpeafa
elkvkelkngrlamfsmfgffvqaivtgkgplenladhla

Sequence, based on observed residues (ATOM records): (download)

>d1vcra_ i.5.1.1 (A:) Chlorophyll a-b binding protein {Garden pea (Pisum sativum)}
petfsknrelevihsrwamlgalgcvfpellsrngsilaiwatqvilmgavegyripeaf
aelkvkelkngrlamfsmfgffvqaivtgkgplenladhla

SCOP Domain Coordinates for d1vcra_:

Click to download the PDB-style file with coordinates for d1vcra_.
(The format of our PDB-style files is described here.)

Timeline for d1vcra_: