SCOPe 2.06: Domain d1vc4b_: 1vc4 B:

Lineage for d1vc4b_ (1vc4 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species)

7. Species Thermus thermophilus [TaxId:274] [102037] (1 PDB entry)

8. Domain d1vc4b_: 1vc4 B: [100558]
   complexed with acy, gol, so4

Details for d1vc4b_

PDB Entry: 1vc4, 1.8 Å

PDB Description: Crystal Structure of Indole-3-Glycerol Phosphate Synthase (TrpC) from Thermus Thermophilus At 1.8 A Resolution

PDB Compounds: (B:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d1vc4b_:

Sequence; same for both SEQRES and ATOM records:

>d1vc4b_ c.1.2.4 (B:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]}
mrpdlsrvpgvlgeiarkrasevapyplpeppsvpsfkeallrpglsviaevkrqspseg
lirevdpveaalayarggaravsvltephrfggslldlkrvreavdlpllrkdfvvdpfm
leearafgasaallivallgeltgayleearrlglealvevhtereleialeagaevlgi
nnrdlatlhinletaprlgrlarkrgfggvlvaesgysrkeelkaleglfdavligtslm
rapdleaalrelvg

Timeline for d1vc4b_:

• d1vc4b_ first appeared in SCOP 1.67
  
• d1vc4b_ appears in SCOPe 2.05
  
• d1vc4b_ appears in SCOPe 2.07
  
• d1vc4b_ appears in the current release, SCOPe 2.08