![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) |
![]() | Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102037] (1 PDB entry) |
![]() | Domain d1vc4b_: 1vc4 B: [100558] complexed with acy, gol, so4 |
PDB Entry: 1vc4 (more details), 1.8 Å
SCOPe Domain Sequences for d1vc4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vc4b_ c.1.2.4 (B:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} mrpdlsrvpgvlgeiarkrasevapyplpeppsvpsfkeallrpglsviaevkrqspseg lirevdpveaalayarggaravsvltephrfggslldlkrvreavdlpllrkdfvvdpfm leearafgasaallivallgeltgayleearrlglealvevhtereleialeagaevlgi nnrdlatlhinletaprlgrlarkrgfggvlvaesgysrkeelkaleglfdavligtslm rapdleaalrelvg
Timeline for d1vc4b_: