Lineage for d1vc4b_ (1vc4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827194Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2827195Protein Indole-3-glycerophosphate synthase, IPGS [51385] (4 species)
  7. 2827210Species Thermus thermophilus [TaxId:274] [102037] (1 PDB entry)
  8. 2827212Domain d1vc4b_: 1vc4 B: [100558]
    complexed with acy, gol, so4

Details for d1vc4b_

PDB Entry: 1vc4 (more details), 1.8 Å

PDB Description: Crystal Structure of Indole-3-Glycerol Phosphate Synthase (TrpC) from Thermus Thermophilus At 1.8 A Resolution
PDB Compounds: (B:) indole-3-glycerol phosphate synthase

SCOPe Domain Sequences for d1vc4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vc4b_ c.1.2.4 (B:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]}
mrpdlsrvpgvlgeiarkrasevapyplpeppsvpsfkeallrpglsviaevkrqspseg
lirevdpveaalayarggaravsvltephrfggslldlkrvreavdlpllrkdfvvdpfm
leearafgasaallivallgeltgayleearrlglealvevhtereleialeagaevlgi
nnrdlatlhinletaprlgrlarkrgfggvlvaesgysrkeelkaleglfdavligtslm
rapdleaalrelvg

SCOPe Domain Coordinates for d1vc4b_:

Click to download the PDB-style file with coordinates for d1vc4b_.
(The format of our PDB-style files is described here.)

Timeline for d1vc4b_: