SCOPe 2.05: Domain d1vc2a2: 1vc2 A:149-310

Lineage for d1vc2a2 (1vc2 A:149-310)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Thermus thermophilus [TaxId:274] [103101] (1 PDB entry)

8. Domain d1vc2a2: 1vc2 A:149-310 [100556]
   Other proteins in same PDB: d1vc2a1
   complexed with nad

Details for d1vc2a2

PDB Entry: 1vc2, 2.6 Å

PDB Description: Crystal structure of Glyceraldehyde 3-Phosphate Dehydrogenase from Thermus thermophilus HB8

PDB Compounds: (A:) glyceraldehyde 3-phosphate dehydrogenase

SCOPe Domain Sequences for d1vc2a2:

Sequence; same for both SEQRES and ATOM records:

>d1vc2a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus thermophilus [TaxId: 274]}
cttnslapvmkvlekafgvekalmttvhsytndqrlldlphkdlrraraaalniiptttg
aakatalvlpslkgrfdgmalrvptptgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlrdivmdphssivdgkltkaignlvkvfawyd

Timeline for d1vc2a2:

• d1vc2a2 first appeared in SCOP 1.67
  
• d1vc2a2 appears in SCOPe 2.04
  
• d1vc2a2 appears in SCOPe 2.06
  
• d1vc2a2 appears in the current release, SCOPe 2.08