Lineage for d1vc2a2 (1vc2 A:149-310)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
N-terminal domain is the classic Rossmann-fold
Family d.81.1.1: GAPDH-like [55348] (4 proteins)
has many additional secondary structures
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species) 
Species Thermus thermophilus [TaxId:274] [103101] (1 PDB entry) 
Domain d1vc2a2: 1vc2 A:149-310 [100556]
Other proteins in same PDB: d1vc2a1
Details for d1vc2a2
PDB Entry: 1vc2 (more details), 2.6 Å
PDB Description: Crystal structure of Glyceraldehyde 3-Phosphate Dehydrogenase from Thermus thermophilus HB8
SCOP Domain Sequences for d1vc2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vc2a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus thermophilus}
cttnslapvmkvlekafgvekalmttvhsytndqrlldlphkdlrraraaalniiptttg
aakatalvlpslkgrfdgmalrvptptgsisditallkrevtaeevnaalkaaaegplkg
ilaytedeivlrdivmdphssivdgkltkaignlvkvfawyd
SCOP Domain Coordinates for d1vc2a2:
Click to download the PDB-style file with coordinates for d1vc2a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vc2a2:
- d1vc2a2 first appeared in SCOP 1.67
- d1vc2a2 appears in SCOP 1.71
- d1vc2a2 appears in the current release, SCOPe 2.08
View in 3D
