![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102157] (1 PDB entry) |
![]() | Domain d1vc2a1: 1vc2 A:1-148,A:311-331 [100555] Other proteins in same PDB: d1vc2a2 complexed with nad |
PDB Entry: 1vc2 (more details), 2.6 Å
SCOPe Domain Sequences for d1vc2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vc2a1 c.2.1.3 (A:1-148,A:311-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus thermophilus [TaxId: 274]} mkvgingfgrigrqvfrilhergvevalindltdnktlahllkydstygrfpgavgydee nlyvdgkairataikdpreipwkqagvgvvvestgvftdgekarahleagakkviitapa kneditvvlgvnheqydpakhhilsnasXnewgyanrvadlvelvlkkgv
Timeline for d1vc2a1: