Lineage for d1vaza_ (1vaz A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516667Fold d.245: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102847] (1 superfamily)
    beta(3)-alpha(2)-beta; 2 layers; mixed beta-sheet, order 4123, strands 1 and 4 are parallel to each other
  4. 516668Superfamily d.245.1: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102848] (1 family) (S)
  5. 516669Family d.245.1.1: NSFL1 (p97 ATPase) cofactor p47, SEP domain [102849] (1 protein)
  6. 516670Protein NSFL1 (p97 ATPase) cofactor p47, SEP domain [102850] (1 species)
  7. 516671Species Rat (Rattus norvegicus) [TaxId:10116] [102851] (1 PDB entry)
  8. 516672Domain d1vaza_: 1vaz A: [100554]

Details for d1vaza_

PDB Entry: 1vaz (more details)

PDB Description: solution structures of the p47 sep domain

SCOP Domain Sequences for d1vaza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vaza_ d.245.1.1 (A:) NSFL1 (p97 ATPase) cofactor p47, SEP domain {Rat (Rattus norvegicus)}
errrhsgqdvhvvlklwktgfsldngdlrsyqdpsnaqflesirrgevpaelrrlahggq
vnldmedhrdedfvkp

SCOP Domain Coordinates for d1vaza_:

Click to download the PDB-style file with coordinates for d1vaza_.
(The format of our PDB-style files is described here.)

Timeline for d1vaza_: