Lineage for d1v9u3_ (1v9u 3:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 966111Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 966284Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 966285Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 966402Protein Rhinovirus coat proteins [49670] (5 species)
  7. 966448Species Human rhinovirus A 2 (HRV-2) [TaxId:12130] [49674] (2 PDB entries)
  8. 966454Domain d1v9u3_: 1v9u 3: [100552]
    Other proteins in same PDB: d1v9u5_
    complexed with ca, dao

Details for d1v9u3_

PDB Entry: 1v9u (more details), 3.6 Å

PDB Description: Human Rhinovirus 2 bound to a fragment of its cellular receptor protein
PDB Compounds: (3:) coat protein vp3

SCOPe Domain Sequences for d1v9u3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9u3_ b.121.4.1 (3:) Rhinovirus coat proteins {Human rhinovirus A 2 (HRV-2) [TaxId: 12130]}
glpvfitpgsgqflttddfqspcalpwyhptkeisipgevknlveicqvdslvpinntdt
yinsenmysvvlqssinapdkifsirtdvasqplattligeissyfthwtgslrfsfmfc
gtanttvklllaytppgiaepttrkdamlgthviwdvglqstismvvpwisashyrntsp
grstsgyitcwyqtrlvippqtpptarllcfvsgckdfclrmardtnlhlqsgaiaq

SCOPe Domain Coordinates for d1v9u3_:

Click to download the PDB-style file with coordinates for d1v9u3_.
(The format of our PDB-style files is described here.)

Timeline for d1v9u3_: