SCOP 1.73: Domain d1v9u1_: 1v9u 1:

Lineage for d1v9u1_ (1v9u 1:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus A 2 (HRV-2) [TaxId:12130] [49674] (2 PDB entries)

8. Domain d1v9u1_: 1v9u 1: [100551]
   Other proteins in same PDB: d1v9u5_
   complexed with ca, dao

Details for d1v9u1_

PDB Entry: 1v9u, 3.6 Å

PDB Description: Human Rhinovirus 2 bound to a fragment of its cellular receptor protein

PDB Compounds: (1:) coat protein vp1

SCOP Domain Sequences for d1v9u1_:

Sequence; same for both SEQRES and ATOM records:

>d1v9u1_ b.121.4.1 (1:) Rhinovirus coat proteins {Human rhinovirus A 2 (HRV-2) [TaxId: 12130]}
lvvpninssnpttsnsapaldaaetghtssvqpedvietryvqtsqtrdemslesflgrs
gcihesklevtlanynkenftvwainlqemaqirrkfelftytrfdseitlvpcisalsq
dighitmqymyvppgapvpnsrddyawqsgtnasvfwqhgqayprfslpflsvasayymf
ydgydeqdqnygtantnnmgslcsrivtekhihkvhimtriyhkakhvkawcprpprale
ytrahrtnfkiedrsiqtaivtrpiitta

Timeline for d1v9u1_:

• d1v9u1_ first appeared in SCOP 1.67
  
• d1v9u1_ appears in SCOP 1.71
  
• d1v9u1_ appears in SCOP 1.75
  
• d1v9u1_ appears in the current release, SCOPe 2.08