Lineage for d1v9pb3 (1v9p B:2001-2317)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928907Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 1928923Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
    automatically mapped to Pfam PF01653
  6. 1928924Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species)
    contains additional, N-terminal all-alpha subdomain
  7. 1928945Species Thermus filiformis [TaxId:276] [56099] (2 PDB entries)
  8. 1928949Domain d1v9pb3: 1v9p B:2001-2317 [100549]
    Other proteins in same PDB: d1v9pa1, d1v9pa2, d1v9pb1, d1v9pb2
    complexed with amp, zn

Details for d1v9pb3

PDB Entry: 1v9p (more details), 2.9 Å

PDB Description: Crystal Structure Of Nad+-Dependent DNA Ligase
PDB Compounds: (B:) DNA ligase

SCOPe Domain Sequences for d1v9pb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9pb3 d.142.2.2 (B:2001-2317) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]}
mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
teqvgarpleptfrpvrhptrmysldnaftyeevlafeerleralgrkrpflytvehkvd
glsvnlyyeegvlvfgatrgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympie
aflrlneeleergekvfknprnaaagslrqkdprvtakrglratfyalglgleesglksq
yelllwlkekgfpvehgyekalgaegveevyrrflaqrhalpfeadgvvvklddlalwre
lgytaraprfalaykfp

SCOPe Domain Coordinates for d1v9pb3:

Click to download the PDB-style file with coordinates for d1v9pb3.
(The format of our PDB-style files is described here.)

Timeline for d1v9pb3: