| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) ![]() has a circularly permuted topology |
| Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (1 protein) |
| Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (2 species) contains additional, N-terminal all-alpha subdomain |
| Species Thermus filiformis [TaxId:276] [56099] (2 PDB entries) |
| Domain d1v9pb3: 1v9p B:2001-2317 [100549] Other proteins in same PDB: d1v9pa1, d1v9pa2, d1v9pb1, d1v9pb2 |
PDB Entry: 1v9p (more details), 2.9 Å
SCOP Domain Sequences for d1v9pb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9pb3 d.142.2.2 (B:2001-2317) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis}
mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
teqvgarpleptfrpvrhptrmysldnaftyeevlafeerleralgrkrpflytvehkvd
glsvnlyyeegvlvfgatrgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympie
aflrlneeleergekvfknprnaaagslrqkdprvtakrglratfyalglgleesglksq
yelllwlkekgfpvehgyekalgaegveevyrrflaqrhalpfeadgvvvklddlalwre
lgytaraprfalaykfp
Timeline for d1v9pb3: