Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins) |
Protein NAD+-dependent DNA ligase [50313] (1 species) |
Species Thermus filiformis [TaxId:276] [50314] (2 PDB entries) |
Domain d1v9pb2: 1v9p B:2318-2403 [100548] Other proteins in same PDB: d1v9pa1, d1v9pa3, d1v9pb1, d1v9pb3 complexed with amp, zn |
PDB Entry: 1v9p (more details), 2.9 Å
SCOPe Domain Sequences for d1v9pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9pb2 b.40.4.6 (B:2318-2403) NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]} aeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnesyieeldirigdwvl vhkaggvipevlrvlkerrtgeerpi
Timeline for d1v9pb2: