Lineage for d1v9pb2 (1v9p B:2318-2403)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790201Family b.40.4.6: DNA ligase/mRNA capping enzyme postcatalytic domain [50307] (5 proteins)
  6. 2790220Protein NAD+-dependent DNA ligase [50313] (1 species)
  7. 2790221Species Thermus filiformis [TaxId:276] [50314] (3 PDB entries)
  8. 2790225Domain d1v9pb2: 1v9p B:2318-2403 [100548]
    Other proteins in same PDB: d1v9pa1, d1v9pa3, d1v9pb1, d1v9pb3
    complexed with amp, zn

Details for d1v9pb2

PDB Entry: 1v9p (more details), 2.9 Å

PDB Description: Crystal Structure Of Nad+-Dependent DNA Ligase
PDB Compounds: (B:) DNA ligase

SCOPe Domain Sequences for d1v9pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9pb2 b.40.4.6 (B:2318-2403) NAD+-dependent DNA ligase {Thermus filiformis [TaxId: 276]}
aeeketrlldvvfqvgrtgrvtpvgvlepvfiegsevsrvtlhnesyieeldirigdwvl
vhkaggvipevlrvlkerrtgeerpi

SCOPe Domain Coordinates for d1v9pb2:

Click to download the PDB-style file with coordinates for d1v9pb2.
(The format of our PDB-style files is described here.)

Timeline for d1v9pb2: