SCOPe 2.07: Domain d1v9pb1: 1v9p B:2404-2584

Lineage for d1v9pb1 (1v9p B:2404-2584)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.2: NAD+-dependent DNA ligase, domain 3 [47786] (1 protein)

6. Protein NAD+-dependent DNA ligase, domain 3 [47787] (1 species)
   duplication: consists of two RuvA-like domains (four HhH motifs); also contains a zinc-finger subdomain

7. Species Thermus filiformis [TaxId:276] [47788] (3 PDB entries)

8. Domain d1v9pb1: 1v9p B:2404-2584 [100547]
   Other proteins in same PDB: d1v9pa2, d1v9pa3, d1v9pb2, d1v9pb3
   complexed with amp, zn

Details for d1v9pb1

PDB Entry: 1v9p, 2.9 Å

PDB Description: Crystal Structure Of Nad+-Dependent DNA Ligase

PDB Compounds: (B:) DNA ligase

SCOPe Domain Sequences for d1v9pb1:

Sequence; same for both SEQRES and ATOM records:

>d1v9pb1 a.60.2.2 (B:2404-2584) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]}
rwpetcpecghrlvkegkvhrcpnplcpakrfeairhyasrkamdieglgeklierllek
glvrdvadlyhlrkedllglermgeksaqnllrqieeskhrglerllyalglpgvgevla
rnlarrfgtmdrlleasleelleveevgeltarailetlkdpafrdlvrrlkeagvsmes
k

Timeline for d1v9pb1:

• d1v9pb1 first appeared in SCOP 1.67
  
• d1v9pb1 appears in SCOPe 2.06
  
• d1v9pb1 appears in the current release, SCOPe 2.08