Lineage for d1v9pb1 (1v9p B:2404-2584)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715662Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 2715687Family a.60.2.2: NAD+-dependent DNA ligase, domain 3 [47786] (1 protein)
  6. 2715688Protein NAD+-dependent DNA ligase, domain 3 [47787] (1 species)
    duplication: consists of two RuvA-like domains (four HhH motifs); also contains a zinc-finger subdomain
  7. 2715689Species Thermus filiformis [TaxId:276] [47788] (3 PDB entries)
  8. 2715693Domain d1v9pb1: 1v9p B:2404-2584 [100547]
    Other proteins in same PDB: d1v9pa2, d1v9pa3, d1v9pb2, d1v9pb3
    complexed with amp, zn

Details for d1v9pb1

PDB Entry: 1v9p (more details), 2.9 Å

PDB Description: Crystal Structure Of Nad+-Dependent DNA Ligase
PDB Compounds: (B:) DNA ligase

SCOPe Domain Sequences for d1v9pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9pb1 a.60.2.2 (B:2404-2584) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]}
rwpetcpecghrlvkegkvhrcpnplcpakrfeairhyasrkamdieglgeklierllek
glvrdvadlyhlrkedllglermgeksaqnllrqieeskhrglerllyalglpgvgevla
rnlarrfgtmdrlleasleelleveevgeltarailetlkdpafrdlvrrlkeagvsmes
k

SCOPe Domain Coordinates for d1v9pb1:

Click to download the PDB-style file with coordinates for d1v9pb1.
(The format of our PDB-style files is described here.)

Timeline for d1v9pb1: