| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) ![]() duplication: contains two helix-hairpin-helix (HhH) motifs |
| Family a.60.2.2: NAD+-dependent DNA ligase, domain 3 [47786] (1 protein) |
| Protein NAD+-dependent DNA ligase, domain 3 [47787] (1 species) duplication: consists of two RuvA-like domains (four HhH motifs); also contains a zinc-finger subdomain |
| Species Thermus filiformis [TaxId:276] [47788] (3 PDB entries) |
| Domain d1v9pb1: 1v9p B:2404-2584 [100547] Other proteins in same PDB: d1v9pa2, d1v9pa3, d1v9pb2, d1v9pb3 complexed with amp, zn |
PDB Entry: 1v9p (more details), 2.9 Å
SCOPe Domain Sequences for d1v9pb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9pb1 a.60.2.2 (B:2404-2584) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]}
rwpetcpecghrlvkegkvhrcpnplcpakrfeairhyasrkamdieglgeklierllek
glvrdvadlyhlrkedllglermgeksaqnllrqieeskhrglerllyalglpgvgevla
rnlarrfgtmdrlleasleelleveevgeltarailetlkdpafrdlvrrlkeagvsmes
k
Timeline for d1v9pb1: