Lineage for d1v9pa3 (1v9p A:1-317)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418907Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 419108Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) (S)
    has a circularly permuted topology
  5. 419116Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (1 protein)
  6. 419117Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (2 species)
    contains additional, N-terminal all-alpha subdomain
  7. 419121Species Thermus filiformis [TaxId:276] [56099] (2 PDB entries)
  8. 419124Domain d1v9pa3: 1v9p A:1-317 [100546]
    Other proteins in same PDB: d1v9pa1, d1v9pa2, d1v9pb1, d1v9pb2

Details for d1v9pa3

PDB Entry: 1v9p (more details), 2.9 Å

PDB Description: Crystal Structure Of Nad+-Dependent DNA Ligase

SCOP Domain Sequences for d1v9pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9pa3 d.142.2.2 (A:1-317) Adenylation domain of NAD+-dependent DNA ligase {Thermus filiformis}
mtreearrrinelrdliryhnyryyvladpeisdaeydrllrelkeleerfpefkspdsp
teqvgarpleptfrpvrhptrmysldnaftyeevlafeerleralgrkrpflytvehkvd
glsvnlyyeegvlvfgatrgdgevgeevtqnlltiptiprrlkgvpdrlevrgevympie
aflrlneeleergekvfknprnaaagslrqkdprvtakrglratfyalglgleesglksq
yelllwlkekgfpvehgyekalgaegveevyrrflaqrhalpfeadgvvvklddlalwre
lgytaraprfalaykfp

SCOP Domain Coordinates for d1v9pa3:

Click to download the PDB-style file with coordinates for d1v9pa3.
(The format of our PDB-style files is described here.)

Timeline for d1v9pa3: