Lineage for d1v9ja_ (1v9j A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411467Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 411541Superfamily d.52.6: BolA-like [82657] (1 family) (S)
  5. 411542Family d.52.6.1: BolA-like [82658] (1 protein)
  6. 411543Protein BolA-like protein [82659] (1 species)
  7. 411544Species Mouse (Mus musculus) [TaxId:10090] [82660] (1 PDB entry)
  8. 411545Domain d1v9ja_: 1v9j A: [100542]
    structural genomics

Details for d1v9ja_

PDB Entry: 1v9j (more details)

PDB Description: solution structure of a bola-like protein from mus musculus

SCOP Domain Sequences for d1v9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9ja_ d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus)}
mkgsshhhhhhssgaslvprgsegaatmelsadylreklrqdleaehvevedttlnrcat
sfrvlvvsakfegkpllqrhrlvneclaeelphihafeqktltpeqwtrqrre

SCOP Domain Coordinates for d1v9ja_:

Click to download the PDB-style file with coordinates for d1v9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1v9ja_: