![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.6: BolA-like [82657] (1 family) ![]() |
![]() | Family d.52.6.1: BolA-like [82658] (3 proteins) Pfam PF01722 |
![]() | Protein BolA-like protein [82659] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [82660] (1 PDB entry) |
![]() | Domain d1v9ja1: 1v9j A:28-113 [100542] Other proteins in same PDB: d1v9ja2 structural genomics |
PDB Entry: 1v9j (more details)
SCOPe Domain Sequences for d1v9ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9ja1 d.52.6.1 (A:28-113) BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]} melsadylreklrqdleaehvevedttlnrcatsfrvlvvsakfegkpllqrhrlvnecl aeelphihafeqktltpeqwtrqrre
Timeline for d1v9ja1: