SCOPe 2.08: Domain d1v9ja1: 1v9j A:28-113

Lineage for d1v9ja1 (1v9j A:28-113)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.6: BolA-like [82657] (1 family)

5. Family d.52.6.1: BolA-like [82658] (3 proteins)
   Pfam PF01722

6. Protein BolA-like protein [82659] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82660] (1 PDB entry)

8. Domain d1v9ja1: 1v9j A:28-113 [100542]
   Other proteins in same PDB: d1v9ja2
   structural genomics

Details for d1v9ja1

PDB Entry: 1v9j

PDB Description: solution structure of a bola-like protein from mus musculus

PDB Compounds: (A:) BolA-like protein RIKEN cDNA 1110025L05

SCOPe Domain Sequences for d1v9ja1:

Sequence; same for both SEQRES and ATOM records:

>d1v9ja1 d.52.6.1 (A:28-113) BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]}
melsadylreklrqdleaehvevedttlnrcatsfrvlvvsakfegkpllqrhrlvnecl
aeelphihafeqktltpeqwtrqrre

Timeline for d1v9ja1:

• d1v9ja1 first appeared in SCOP 1.67, called d1v9ja_
  
• d1v9ja1 appears in SCOPe 2.07