Lineage for d1v9ja1 (1v9j A:28-113)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170593Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2170755Superfamily d.52.6: BolA-like [82657] (1 family) (S)
  5. 2170756Family d.52.6.1: BolA-like [82658] (3 protein domains)
    Pfam PF01722
  6. 2170757Protein BolA-like protein [82659] (1 species)
  7. 2170758Species Mouse (Mus musculus) [TaxId:10090] [82660] (1 PDB entry)
  8. 2170759Domain d1v9ja1: 1v9j A:28-113 [100542]
    Other proteins in same PDB: d1v9ja2
    structural genomics

Details for d1v9ja1

PDB Entry: 1v9j (more details)

PDB Description: Solution structure of a BolA-like protein from Mus musculus
PDB Compounds: (A:) BolA-like protein RIKEN cDNA 1110025L05

SCOPe Domain Sequences for d1v9ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9ja1 d.52.6.1 (A:28-113) BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]}
melsadylreklrqdleaehvevedttlnrcatsfrvlvvsakfegkpllqrhrlvnecl
aeelphihafeqktltpeqwtrqrre

SCOPe Domain Coordinates for d1v9ja1:

Click to download the PDB-style file with coordinates for d1v9ja1.
(The format of our PDB-style files is described here.)

Timeline for d1v9ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v9ja2