Lineage for d1v9ic_ (1v9i C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1556573Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1556574Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1556575Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1556576Protein Carbonic anhydrase [51071] (10 species)
  7. 1556577Species Cow (Bos taurus), isozyme II [TaxId:9913] [51074] (3 PDB entries)
  8. 1556581Domain d1v9ic_: 1v9i C: [100541]
    complexed with zn; mutant

Details for d1v9ic_

PDB Entry: 1v9i (more details), 2.95 Å

PDB Description: crystal structure analysis of the site specific mutant (q253c) of bovine carbonic anhydrase ii
PDB Compounds: (C:) carbonic anhydrase II

SCOPe Domain Sequences for d1v9ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9ic_ b.74.1.1 (C:) Carbonic anhydrase {Cow (Bos taurus), isozyme II [TaxId: 9913]}
rcshhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrm
vnnghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelh
lvhwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfd
pgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepell
mlanwrpaqplknrcvrgfpk

SCOPe Domain Coordinates for d1v9ic_:

Click to download the PDB-style file with coordinates for d1v9ic_.
(The format of our PDB-style files is described here.)

Timeline for d1v9ic_: