SCOP 1.71: Domain d1v9ic_: 1v9i C:

Lineage for d1v9ic_ (1v9i C:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Cow (Bos taurus), isozyme II [TaxId:9913] [51074] (3 PDB entries)

8. Domain d1v9ic_: 1v9i C: [100541]
   complexed with zn; mutant

Details for d1v9ic_

PDB Entry: 1v9i, 2.95 Å

PDB Description: crystal structure analysis of the site specific mutant (q253c) of bovine carbonic anhydrase ii

SCOP Domain Sequences for d1v9ic_:

Sequence; same for both SEQRES and ATOM records:

>d1v9ic_ b.74.1.1 (C:) Carbonic anhydrase {Cow (Bos taurus), isozyme II}
rcshhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrm
vnnghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelh
lvhwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfd
pgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepell
mlanwrpaqplknrcvrgfpk

Timeline for d1v9ic_:

• d1v9ic_ first appeared in SCOP 1.67
  
• d1v9ic_ appears in SCOP 1.69
  
• d1v9ic_ appears in SCOP 1.73
  
• d1v9ic_ appears in the current release, SCOPe 2.08, called d1v9ic1