Lineage for d1v9ic_ (1v9i C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380456Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 380457Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 380458Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 380459Protein Carbonic anhydrase [51071] (10 species)
  7. 380460Species Cow (Bos taurus), isozyme II [TaxId:9913] [51074] (3 PDB entries)
  8. 380464Domain d1v9ic_: 1v9i C: [100541]
    complexed with zn; mutant

Details for d1v9ic_

PDB Entry: 1v9i (more details), 2.95 Å

PDB Description: crystal structure analysis of the site specific mutant (q253c) of bovine carbonic anhydrase ii

SCOP Domain Sequences for d1v9ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9ic_ b.74.1.1 (C:) Carbonic anhydrase {Cow (Bos taurus), isozyme II}
rcshhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrm
vnnghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelh
lvhwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfd
pgsllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepell
mlanwrpaqplknrcvrgfpk

SCOP Domain Coordinates for d1v9ic_:

Click to download the PDB-style file with coordinates for d1v9ic_.
(The format of our PDB-style files is described here.)

Timeline for d1v9ic_: