Lineage for d1v9ea_ (1v9e A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961516Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 961517Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 961518Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 961519Protein Carbonic anhydrase [51071] (10 species)
  7. 961520Species Cow (Bos taurus), isozyme II [TaxId:9913] [51074] (3 PDB entries)
  8. 961521Domain d1v9ea_: 1v9e A: [100539]
    complexed with zn

Details for d1v9ea_

PDB Entry: 1v9e (more details), 1.95 Å

PDB Description: Crystal Structure Analysis of Bovine Carbonic Anhydrase II
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1v9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9ea_ b.74.1.1 (A:) Carbonic anhydrase {Cow (Bos taurus), isozyme II [TaxId: 9913]}
shhwgygkhngpehwhkdfpiangerqspvdidtkavvqdpalkplalvygeatsrrmvn
nghsfnveyddsqdkavlkdgpltgtyrlvqfhfhwgssddqgsehtvdrkkyaaelhlv
hwntkygdfgtaaqqpdglavvgvflkvgdanpalqkvldaldsiktkgkstdfpnfdpg
sllpnvldywtypgslttppllesvtwivlkepisvssqqmlkfrtlnfnaegepellml
anwrpaqplknrqvrgfpk

SCOPe Domain Coordinates for d1v9ea_:

Click to download the PDB-style file with coordinates for d1v9ea_.
(The format of our PDB-style files is described here.)

Timeline for d1v9ea_: