Lineage for d1v9dc_ (1v9d C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 362579Fold a.207: Formin homology 2 domain (FH2 domain) [101446] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 362580Superfamily a.207.1: Formin homology 2 domain (FH2 domain) [101447] (1 family) (S)
  5. 362581Family a.207.1.1: Formin homology 2 domain (FH2 domain) [101448] (2 proteins)
  6. 362587Protein Diaphanous protein homolog 1, dia1 [101449] (1 species)
  7. 362588Species Mouse (Mus musculus) [TaxId:10090] [101450] (1 PDB entry)
  8. 362591Domain d1v9dc_: 1v9d C: [100537]

Details for d1v9dc_

PDB Entry: 1v9d (more details), 2.6 Å

PDB Description: Crystal structure of the core FH2 domain of mouse mDia1

SCOP Domain Sequences for d1v9dc_:

Sequence, based on SEQRES records: (download)

>d1v9dc_ a.207.1.1 (C:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus)}
vkelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpepeqlk
mlselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsvtaace
elrksenfsslleltllvgnymnagsrnagafgfnisflcklrdtksadqkmtllhflae
lcendhpevlkfpdelahvekasrvsaenlqksldqmkkqiadverdvqnfpaatdekdk
fvekmtsfvkdaqeqynklrmmhsnmetlykelgdyfvfdpkklsveeffmdlhnfrnmf
lqavkenqkrreteekmrrakl

Sequence, based on observed residues (ATOM records): (download)

>d1v9dc_ a.207.1.1 (C:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus)}
vkelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpepeqlk
mlselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsvtaace
elrknfssllelmtllhflaelcendhpevllahvekasrvsaenlqksldqmkkqiadv
erdvqnfpaatdekdkfvekmtsfvkdaqeqynklrmmhsnmetlykelgdyfvfdpkkl
sveeffmdlhnfrnmflqavkenqkrreteekmrrakl

SCOP Domain Coordinates for d1v9dc_:

Click to download the PDB-style file with coordinates for d1v9dc_.
(The format of our PDB-style files is described here.)

Timeline for d1v9dc_: