Lineage for d1v9db_ (1v9d B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736549Fold a.207: Formin homology 2 domain (FH2 domain) [101446] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2736550Superfamily a.207.1: Formin homology 2 domain (FH2 domain) [101447] (1 family) (S)
    automatically mapped to Pfam PF02181
  5. 2736551Family a.207.1.1: Formin homology 2 domain (FH2 domain) [101448] (2 proteins)
  6. 2736558Protein Diaphanous protein homolog 1, dia1 [101449] (1 species)
  7. 2736559Species Mouse (Mus musculus) [TaxId:10090] [101450] (1 PDB entry)
  8. 2736561Domain d1v9db_: 1v9d B: [100536]
    complexed with so4

Details for d1v9db_

PDB Entry: 1v9d (more details), 2.6 Å

PDB Description: Crystal structure of the core FH2 domain of mouse mDia1
PDB Compounds: (B:) Diaphanous protein homolog 1

SCOPe Domain Sequences for d1v9db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9db_ a.207.1.1 (B:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]}
kelkvldsktaqnlsiflgsfrmpyqeiknvilevneavltesmiqnlikqmpepeqlkm
lselkeeyddlaeseqfgvvmgtvprlrprlnailfklqfseqvenikpeivsvtaacee
lrksenfsslleltllvgnymnagsrnagafgfnisflcklrdtksadqkmtllhflael
cendhpevlkfpdelahvekasrvsaenlqksldqmkkqiadverdvqnfpaatdekdkf
vekmtsfvkdaqeqynklrmmhsnmetlykelgdyfvfdpkklsveeffmdlhnfrnmfl
qavkenqkrreteekmrrakl

SCOPe Domain Coordinates for d1v9db_:

Click to download the PDB-style file with coordinates for d1v9db_.
(The format of our PDB-style files is described here.)

Timeline for d1v9db_: