Lineage for d1v9cb_ (1v9c B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2859540Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) (S)
    fold elaborated with additional structures
    automatically mapped to Pfam PF02570
  5. 2859541Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins)
  6. 2859542Protein Precorrin-8x methylmutase [63967] (2 species)
  7. 2859546Species Thermus thermophilus [TaxId:274] [102247] (1 PDB entry)
  8. 2859548Domain d1v9cb_: 1v9c B: [100534]
    complexed with cl, so4

Details for d1v9cb_

PDB Entry: 1v9c (more details), 2.2 Å

PDB Description: Crystal Analysis of Precorrin-8x Methyl Mutase from Thermus Thermophilus
PDB Compounds: (B:) Precorrin-8x Methyl Mutase

SCOPe Domain Sequences for d1v9cb_:

Sequence, based on SEQRES records: (download)

>d1v9cb_ c.23.17.1 (B:) Precorrin-8x methylmutase {Thermus thermophilus [TaxId: 274]}
graieeesfrivdqeagphgfsplewpvvrrmihatadfeykaltrfsqgaveaglkaiq
agarilvdarmiacglnperlrlfgnevvellahpevvarakatggtraeaavayawekg
lldgaivgvgnaptfllalveairqgarpalvlgmpvgfvnvleakralmeapvpwivte
grkggstlvvaalhalirlaadggvdts

Sequence, based on observed residues (ATOM records): (download)

>d1v9cb_ c.23.17.1 (B:) Precorrin-8x methylmutase {Thermus thermophilus [TaxId: 274]}
graieeesfrivdqeagphgfsplewpvvrrmihatadfeykaltrfsqgaveaglkaiq
agarilvdarmiacglnperlrlfgnevvellahpevvarakattraeaavayawekgll
dgaivgvgnaptfllalveairqgarpalvlgmpvgfvnvleakralmeapvpwivtegr
kggstlvvaalhalirlaadggvdts

SCOPe Domain Coordinates for d1v9cb_:

Click to download the PDB-style file with coordinates for d1v9cb_.
(The format of our PDB-style files is described here.)

Timeline for d1v9cb_: