Lineage for d1v93a_ (1v93 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840637Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families) (S)
    distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation
  5. 2840638Family c.1.23.1: Methylenetetrahydrofolate reductase [51731] (2 proteins)
    automatically mapped to Pfam PF02219
  6. 2840639Protein Methylenetetrahydrofolate reductase [51732] (2 species)
  7. 2840662Species Thermus thermophilus [TaxId:274] [102106] (1 PDB entry)
  8. 2840663Domain d1v93a_: 1v93 A: [100532]
    complexed with dio, fad

Details for d1v93a_

PDB Entry: 1v93 (more details), 1.9 Å

PDB Description: 5,10-Methylenetetrahydrofolate Reductase from Thermus thermophilus HB8
PDB Compounds: (A:) 5,10-Methylenetetrahydrofolate reductase

SCOPe Domain Sequences for d1v93a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v93a_ c.1.23.1 (A:) Methylenetetrahydrofolate reductase {Thermus thermophilus [TaxId: 274]}
mkirdllkarrgplfsfeffppkdpegeealfrtleelkafrpafvsitygamgstrers
vawaqriqslglnplahltvagqsrkevaevlhrfvesgvenllalrgdpprgervfrph
pegfryaaelvalirerygdrvsvggaaypeghpesesleadlrhfkakveagldfaitq
lffnnahyfgflerarragigipilpgimpvtsyrqlrrftevcgasipgpllaklerhq
ddpkavleigvehavrqvaelleagvegvhfytlnkspatrmvlerlglrpa

SCOPe Domain Coordinates for d1v93a_:

Click to download the PDB-style file with coordinates for d1v93a_.
(The format of our PDB-style files is described here.)

Timeline for d1v93a_: