Lineage for d1v92a_ (1v92 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352395Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
    3 helices; bundle, right-handed twist
  4. 352419Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 352446Family a.5.2.3: TAP-C domain-like [68973] (2 proteins)
  6. 352451Protein NSFL1 (p97 ATPase) cofactor p47, UBA-like domain [101067] (1 species)
  7. 352452Species Rat (Rattus norvegicus) [TaxId:10116] [101068] (1 PDB entry)
  8. 352453Domain d1v92a_: 1v92 A: [100531]

Details for d1v92a_

PDB Entry: 1v92 (more details)

PDB Description: solution structure of the uba domain from p47, a major cofactor of the aaa atpase p97

SCOP Domain Sequences for d1v92a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus)}
maeerqdalrefvavtgaeedrarfflesagwdlqialasfyedgg

SCOP Domain Coordinates for d1v92a_:

Click to download the PDB-style file with coordinates for d1v92a_.
(The format of our PDB-style files is described here.)

Timeline for d1v92a_: